RAB40A antibody (70R-5855)

Rabbit polyclonal RAB40A antibody raised against the middle region of RAB40A

Synonyms Polyclonal RAB40A antibody, Anti-RAB40A antibody, RAR2A antibody, MGC142061 antibody, RABA 40 antibody, Rab40A Member Ras Oncogene Family antibody, RABA 40, Rar-2 antibody, RABA-40 antibody, RAB40A, RABA-40
Specificity RAB40A antibody was raised against the middle region of RAB40A
Cross Reactivity Human
Applications WB
Immunogen RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Assay Information RAB40A Blocking Peptide, catalog no. 33R-8107, is also available for use as a blocking control in assays to test for specificity of this RAB40A antibody

Images

Western Blot analysis using RAB40A antibody (70R-5855)

RAB40A antibody (70R-5855) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB40A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB40A antibody (70R-5855) | RAB40A antibody (70R-5855) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors