RAB40B antibody (70R-5856)

Rabbit polyclonal RAB40B antibody raised against the middle region of RAB40B

Synonyms Polyclonal RAB40B antibody, Anti-RAB40B antibody, SEC4L antibody, FLJ42385 antibody, RAB40B, RABB-40, Rab40B Member Ras Oncogene Family antibody, RABB 40, RAR antibody, RABB-40 antibody, RABB 40 antibody
Specificity RAB40B antibody was raised against the middle region of RAB40B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAB40B antibody was raised using the middle region of RAB40B corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ
Assay Information RAB40B Blocking Peptide, catalog no. 33R-10045, is also available for use as a blocking control in assays to test for specificity of this RAB40B antibody

Images

Western Blot analysis using RAB40B antibody (70R-5856)

RAB40B antibody (70R-5856) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB40B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB40B has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAB40B antibody (70R-5856) | RAB40B antibody (70R-5856) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors