RABEPK antibody (70R-4502)

Rabbit polyclonal RABEPK antibody raised against the N terminal of RABEPK

Synonyms Polyclonal RABEPK antibody, Anti-RABEPK antibody, bA65N13.1 antibody, p40 antibody, Rab9 Effector Protein With Kelch Motifs antibody, DKFZp686P1077 antibody, RAB9P40 antibody
Specificity RABEPK antibody was raised against the N terminal of RABEPK
Cross Reactivity Human
Applications WB
Immunogen RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV
Assay Information RABEPK Blocking Peptide, catalog no. 33R-6159, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Images

Western Blot analysis using RABEPK antibody (70R-4502)

RABEPK antibody (70R-4502) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RABEPK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RABEPK antibody (70R-4502) | RABEPK antibody (70R-4502) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors