RABGEF1 antibody (70R-3156)

Rabbit polyclonal RABGEF1 antibody

Synonyms Polyclonal RABGEF1 antibody, Anti-RABGEF1 antibody, FLJ32302 antibody, RABEX5 antibody, Gef 1 antibody, rabex-5 antibody, RABGEF-1, Rab RNA guanine Nucleotide Exchange Factor antibody, RABGEF 1 antibody, RABGEF-1 antibody, RABGEF 1, RABGEF1
Cross Reactivity Human
Applications WB
Immunogen RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
Assay Information RABGEF1 Blocking Peptide, catalog no. 33R-6460, is also available for use as a blocking control in assays to test for specificity of this RABGEF1 antibody

Images

Western Blot analysis using RABGEF1 antibody (70R-3156)

RABGEF1 antibody (70R-3156) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RABGEF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RABGEF1 antibody (70R-3156) | RABGEF1 antibody (70R-3156) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors