RAD17 antibody (70R-3246)

Rabbit polyclonal RAD17 antibody

Synonyms Polyclonal RAD17 antibody, Anti-RAD17 antibody, CCYC antibody, RAD-17, Rad24 antibody, R24L antibody, RAD17Sp antibody, RAD 17 antibody, Rad17 Homolog antibody, HRAD17 antibody, RAD-17 antibody, RAD 17, RAD17
Cross Reactivity Human
Applications WB
Immunogen RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
Assay Information RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Images

Western Blot analysis using RAD17 antibody (70R-3246)

RAD17 antibody (70R-3246) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD17 antibody (70R-3246) | RAD17 antibody (70R-3246) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors