RAD23B antibody (70R-3307)

Rabbit polyclonal RAD23B antibody

Synonyms Polyclonal RAD23B antibody, Anti-RAD23B antibody, HR23B antibody, HHR23B antibody, RAD23B, RADB-23 antibody, Rad23 Homolog B antibody, RADB-23, RADB 23 antibody, RADB 23, P58 antibody
Cross Reactivity Human
Applications WB
Immunogen RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
Assay Information RAD23B Blocking Peptide, catalog no. 33R-7736, is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody


Western Blot analysis using RAD23B antibody (70R-3307)

RAD23B antibody (70R-3307) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD23B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAD23B antibody (70R-3307) | RAD23B antibody (70R-3307) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors