RAD54B antibody (70R-5648)

Rabbit polyclonal RAD54B antibody

Synonyms Polyclonal RAD54B antibody, Anti-RAD54B antibody, RAD54B, RADB 54, FSBP antibody, RADB 54 antibody, Rad54 Homolog B antibody, RADB-54, RADB-54 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
Assay Information RAD54B Blocking Peptide, catalog no. 33R-1865, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Images

Western Blot analysis using RAD54B antibody (70R-5648)

RAD54B antibody (70R-5648) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD54B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD54B antibody (70R-5648) | RAD54B antibody (70R-5648) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors