RAD54B antibody (70R-5653)

Rabbit polyclonal RAD54B antibody

Synonyms Polyclonal RAD54B antibody, Anti-RAD54B antibody, Rad54 Homolog B antibody, RADB 54, FSBP antibody, RADB-54 antibody, RADB 54 antibody, RAD54B, RADB-54
Cross Reactivity Human
Applications WB
Immunogen RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN
Assay Information RAD54B Blocking Peptide, catalog no. 33R-8160, is also available for use as a blocking control in assays to test for specificity of this RAD54B antibody

Images

Western Blot analysis using RAD54B antibody (70R-5653)

RAD54B antibody (70R-5653) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD54B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD54B antibody (70R-5653) | RAD54B antibody (70R-5653) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors