RAD9B antibody (70R-5622)

Rabbit polyclonal RAD9B antibody

Synonyms Polyclonal RAD9B antibody, Anti-RAD9B antibody, RADB-9 antibody, RADB-9, RAD9B, MGC75426 antibody, RADB 9, RADB 9 antibody, FLJ40346 antibody, Rad9 Homolog B antibody
Cross Reactivity Human
Applications WB
Immunogen RAD9B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED
Assay Information RAD9B Blocking Peptide, catalog no. 33R-8859, is also available for use as a blocking control in assays to test for specificity of this RAD9B antibody

Images

Western Blot analysis using RAD9B antibody (70R-5622)

RAD9B antibody (70R-5622) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD9B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RAD9B protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD9B antibody (70R-5622) | RAD9B antibody (70R-5622) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors