RAE1 antibody (70R-4676)

Rabbit polyclonal RAE1 antibody

Synonyms Polyclonal RAE1 antibody, Anti-RAE1 antibody, RAE 1 antibody, RAE 1, RAE-1, RAE1, RAE-1 antibody, Rae1 Rna Export 1 Homolog antibody
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
Assay Information RAE1 Blocking Peptide, catalog no. 33R-8290, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody

Images

Immunohistochemical staining using RAE1 antibody (70R-4676)

RAE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using RAE1 antibody (70R-4676) | RAE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RAE1 antibody (70R-4676) | RAE1 antibody (70R-4676) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors