RAGE antibody (70R-4337)

Rabbit polyclonal RAGE antibody raised against the N terminal of RAGE

Synonyms Polyclonal RAGE antibody, Anti-RAGE antibody, Renal Tumor Antigen antibody, MOK antibody, RAGE1 antibody
Specificity RAGE antibody was raised against the N terminal of RAGE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL
Assay Information RAGE Blocking Peptide, catalog no. 33R-6160, is also available for use as a blocking control in assays to test for specificity of this RAGE antibody

Images

Western Blot analysis using RAGE antibody (70R-4337)

RAGE antibody (70R-4337) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAGE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

References
Add a Paper

Tony Valentea, Alejandro Gellab, Xavier Fernàndez-Busquetsc, Mercedes Unzetaa, Nuria Durany

Immunohistochemical analysis of human brain suggests pathological synergism of Alzheimer's disease and diabetes mellitus

Neurobiology of Disease

Volume: 37 Issue: 1 Page: 67-76 DOI: 10.1016/j.nbd.2009.09.008

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAGE antibody (70R-4337) | RAGE antibody (70R-4337) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors