RAI14 antibody (70R-3542)

Rabbit polyclonal RAI14 antibody raised against the middle region of RAI14

Synonyms Polyclonal RAI14 antibody, Anti-RAI14 antibody, RAI 14, NORPEG antibody, DKFZp564G013 antibody, RAI-14, KIAA1334 antibody, RAI14, Retinoic Acid Induced 14 antibody, RAI 14 antibody, RAI-14 antibody, RAI13 antibody
Specificity RAI14 antibody was raised against the middle region of RAI14
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids LSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAED
Assay Information RAI14 Blocking Peptide, catalog no. 33R-5446, is also available for use as a blocking control in assays to test for specificity of this RAI14 antibody


Western Blot analysis using RAI14 antibody (70R-3542)

RAI14 antibody (70R-3542) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAI14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAI14 antibody (70R-3542) | RAI14 antibody (70R-3542) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors