RAI16 antibody (70R-4019)

Rabbit polyclonal RAI16 antibody raised against the N terminal of RAI16

Synonyms Polyclonal RAI16 antibody, Anti-RAI16 antibody, RAI 16 antibody, MGC138352 antibody, Family With Sequence Similarity 160 Member B2 antibody, RAI-16, FLJ11125 antibody, RAI-16 antibody, FLJ21801 antibody, RAI16, RAI 16
Specificity RAI16 antibody was raised against the N terminal of RAI16
Cross Reactivity Human
Applications WB
Immunogen RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLL
Assay Information RAI16 Blocking Peptide, catalog no. 33R-3883, is also available for use as a blocking control in assays to test for specificity of this RAI16 antibody


Western Blot analysis using RAI16 antibody (70R-4019)

RAI16 antibody (70R-4019) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAI16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RAI16 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAI16 antibody (70R-4019) | RAI16 antibody (70R-4019) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors