RALB antibody (70R-4028)

Rabbit polyclonal RALB antibody

Synonyms Polyclonal RALB antibody, Anti-RALB antibody, Ras Related Gtp Binding Protein antibody, V-Ral Simian Leukemia Viral Oncogene Homolog B antibody
Cross Reactivity Human
Applications WB
Immunogen RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
Assay Information RALB Blocking Peptide, catalog no. 33R-3044, is also available for use as a blocking control in assays to test for specificity of this RALB antibody


Western Blot analysis using RALB antibody (70R-4028)

RALB antibody (70R-4028) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RALB antibody (70R-4028) | RALB antibody (70R-4028) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors