RALGDS antibody (70R-4313)

Rabbit polyclonal RALGDS antibody raised against the N terminal of RALGDS

Synonyms Polyclonal RALGDS antibody, Anti-RALGDS antibody, RGF antibody, FLJ20922 antibody, Ral RNA guanine Nucleotide Dissociation Stimulator antibody, RalGEF antibody
Specificity RALGDS antibody was raised against the N terminal of RALGDS
Cross Reactivity Human
Applications WB
Immunogen RALGDS antibody was raised using the N terminal of RALGDS corresponding to a region with amino acids KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED
Assay Information RALGDS Blocking Peptide, catalog no. 33R-4641, is also available for use as a blocking control in assays to test for specificity of this RALGDS antibody


Western Blot analysis using RALGDS antibody (70R-4313)

RALGDS antibody (70R-4313) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALGDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RALGDS protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RALGDS antibody (70R-4313) | RALGDS antibody (70R-4313) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors