RALGPS1 antibody (70R-5724)

Rabbit polyclonal RALGPS1 antibody raised against the middle region of RALGPS1

Synonyms Polyclonal RALGPS1 antibody, Anti-RALGPS1 antibody, RALGPS 1, RALGPS1, RALGPS1A antibody, KIAA0351 antibody, Ral Gef With Ph Domain And Sh3 Binding Motif 1 antibody, RALGPS-1, RALGEF2 antibody, RALGPS 1 antibody, RALGPS-1 antibody
Specificity RALGPS1 antibody was raised against the middle region of RALGPS1
Cross Reactivity Human,Mouse
Applications WB
Immunogen RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL
Assay Information RALGPS1 Blocking Peptide, catalog no. 33R-1222, is also available for use as a blocking control in assays to test for specificity of this RALGPS1 antibody

Images

Western Blot analysis using RALGPS1 antibody (70R-5724)

RALGPS1 antibody (70R-5724) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALGPS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RALGPS1 antibody (70R-5724) | RALGPS1 antibody (70R-5724) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors