RALGPS2 antibody (70R-2184)

Rabbit polyclonal RALGPS2 antibody raised against the n terminal of RALGPS2

Synonyms Polyclonal RALGPS2 antibody, Anti-RALGPS2 antibody, RALGPS-2, FLJ10244 antibody, Ral Gef With Ph Domain And Sh3 Binding Motif 2 antibody, RP4-595C2.1 antibody, dJ595C2.1 antibody, FLJ25604 antibody, RALGPS 2 antibody, RALGPS-2 antibody, RALGPS2, KIAA0351 antibody, RALGPS 2
Specificity RALGPS2 antibody was raised against the n terminal of RALGPS2
Cross Reactivity Human
Applications WB
Immunogen RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP
Assay Information RALGPS2 Blocking Peptide, catalog no. 33R-5849, is also available for use as a blocking control in assays to test for specificity of this RALGPS2 antibody


Western Blot analysis using RALGPS2 antibody (70R-2184)

RALGPS2 antibody (70R-2184) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALGPS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RALGPS2 antibody (70R-2184) | RALGPS2 antibody (70R-2184) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors