RanGAP1 antibody (70R-5479)

Rabbit polyclonal RanGAP1 antibody raised against the N terminal of RANGAP1

Synonyms Polyclonal RanGAP1 antibody, Anti-RanGAP1 antibody, Ran Gtpase Activating Protein 1 antibody, RanGAP1, Fug1 antibody, MGC20266 antibody, RanGAP 1 antibody, SD antibody, RanGAP-1, RanGAP-1 antibody, KIAA1835 antibody, RanGAP 1
Specificity RanGAP1 antibody was raised against the N terminal of RANGAP1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS
Assay Information RanGAP1 Blocking Peptide, catalog no. 33R-5742, is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody


Western Blot analysis using RanGAP1 antibody (70R-5479)

RanGAP1 antibody (70R-5479) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RANGAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RanGAP1 antibody (70R-5479) | RanGAP1 antibody (70R-5479) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors