RAPGEF1 antibody (70R-5717)

Rabbit polyclonal RAPGEF1 antibody

Synonyms Polyclonal RAPGEF1 antibody, Anti-RAPGEF1 antibody, RAPGEF-1, RAPGEF 1 antibody, RAPGEF1, RAPGEF 1, C3G antibody, Gef 1 antibody, Rap RNA guanine Nucleotide Exchange Factor antibody, GRF2 antibody, RAPGEF-1 antibody, DKFZp781P1719 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAPGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK
Assay Information RAPGEF1 Blocking Peptide, catalog no. 33R-5553, is also available for use as a blocking control in assays to test for specificity of this RAPGEF1 antibody

Images

Western Blot analysis using RAPGEF1 antibody (70R-5717)

RAPGEF1 antibody (70R-5717) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAPGEF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAPGEF1 antibody (70R-5717) | RAPGEF1 antibody (70R-5717) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors