RAPGEF3 antibody (70R-4545)

Rabbit polyclonal RAPGEF3 antibody

Synonyms Polyclonal RAPGEF3 antibody, Anti-RAPGEF3 antibody, RAPGEF-3 antibody, EPAC antibody, CAMP-GEFI antibody, bcm910 antibody, RAPGEF-3, MGC21410 antibody, RAPGEF3, Gef 3 antibody, EPAC1 antibody, RAPGEF 3, Rap RNA guanine Nucleotide Exchange Factor antibody, RAPGEF 3 antibody
Cross Reactivity Human
Applications WB
Immunogen RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
Assay Information RAPGEF3 Blocking Peptide, catalog no. 33R-8206, is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody


Western Blot analysis using RAPGEF3 antibody (70R-4545)

RAPGEF3 antibody (70R-4545) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAPGEF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAPGEF3 antibody (70R-4545) | RAPGEF3 antibody (70R-4545) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors