RASGRP2 antibody (70R-5804)

Rabbit polyclonal RASGRP2 antibody

Synonyms Polyclonal RASGRP2 antibody, Anti-RASGRP2 antibody, Calcium And Dag-Regulated antibody, CDC25L antibody, Ras Guanyl Releasing Protein 2 antibody, CALDAG-GEFI antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS
Assay Information RASGRP2 Blocking Peptide, catalog no. 33R-5537, is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody


Western Blot analysis using RASGRP2 antibody (70R-5804)

RASGRP2 antibody (70R-5804) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASGRP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RASGRP2 antibody (70R-5804) | RASGRP2 antibody (70R-5804) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors