RASL10A antibody (70R-5853)

Rabbit polyclonal RASL10A antibody raised against the N terminal of RASL10A

Synonyms Polyclonal RASL10A antibody, Anti-RASL10A antibody, Ras-Like Family 10 Member A antibody, RASL-10 antibody, RASL 10 antibody, RASL 10, RRP22 antibody, RASL10, RASL-10
Specificity RASL10A antibody was raised against the N terminal of RASL10A
Cross Reactivity Human
Applications WB
Immunogen RASL10A antibody was raised using the N terminal of RASL10A corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ
Assay Information RASL10A Blocking Peptide, catalog no. 33R-7384, is also available for use as a blocking control in assays to test for specificity of this RASL10A antibody


Western Blot analysis using RASL10A antibody (70R-5853)

RASL10A antibody (70R-5853) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASL10A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of RASL10A is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RASL10A antibody (70R-5853) | RASL10A antibody (70R-5853) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors