RASL12 antibody (70R-5822)

Rabbit polyclonal RASL12 antibody raised against the N terminal of RASL12

Synonyms Polyclonal RASL12 antibody, Anti-RASL12 antibody, RIS antibody, RASL-12 antibody, RASL-12, RASL 12 antibody, RASL 12, RASL12, Ras-Like Family 12 antibody
Specificity RASL12 antibody was raised against the N terminal of RASL12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RASL12 antibody was raised using the N terminal of RASL12 corresponding to a region with amino acids MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD
Assay Information RASL12 Blocking Peptide, catalog no. 33R-6517, is also available for use as a blocking control in assays to test for specificity of this RASL12 antibody

Images

Western Blot analysis using RASL12 antibody (70R-5822)

RASL12 antibody (70R-5822) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RASL12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RASL12 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RASL12 antibody (70R-5822) | RASL12 antibody (70R-5822) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors