RAVER1 antibody (70R-1457)

Rabbit polyclonal RAVER1 antibody raised against the N terminal of RAVER1

Synonyms Polyclonal RAVER1 antibody, Anti-RAVER1 antibody, Ribonucleoprotein Ptb-Binding 1 antibody, RAVER 1 antibody, RAVER-1 antibody, RAVER 1, RAVER-1, RAVER1
Specificity RAVER1 antibody was raised against the N terminal of RAVER1
Cross Reactivity Human
Applications IHC, WB
Immunogen RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR
Assay Information RAVER1 Blocking Peptide, catalog no. 33R-9845, is also available for use as a blocking control in assays to test for specificity of this RAVER1 antibody

Images

Western Blot analysis using RAVER1 antibody (70R-1457)

RAVER1 antibody (70R-1457) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RAVER1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAVER1 antibody (70R-1457) | RAVER1 antibody (70R-1457) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors