RAVER2 antibody (70R-4637)

Rabbit polyclonal RAVER2 antibody raised against the middle region of RAVER2

Synonyms Polyclonal RAVER2 antibody, Anti-RAVER2 antibody, KIAA1579 antibody, FLJ10770 antibody, RAVER 2, RAVER-2, RAVER-2 antibody, DKFZp762D1011 antibody, RAVER2, RAVER 2 antibody, Ribonucleoprotein Ptb-Binding 2 antibody
Specificity RAVER2 antibody was raised against the middle region of RAVER2
Cross Reactivity Human
Applications WB
Immunogen RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
Assay Information RAVER2 Blocking Peptide, catalog no. 33R-9130, is also available for use as a blocking control in assays to test for specificity of this RAVER2 antibody


Western Blot analysis using RAVER2 antibody (70R-4637)

RAVER2 antibody (70R-4637) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAVER2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAVER2 may bind single stranded nucleic acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAVER2 antibody (70R-4637) | RAVER2 antibody (70R-4637) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors