RBBP7 antibody (70R-2124)

Rabbit polyclonal RBBP7 antibody raised against the N terminal of RBBP7

Synonyms Polyclonal RBBP7 antibody, Anti-RBBP7 antibody, RBBP-7, RBBP 7 antibody, RBBP-7 antibody, MGC138867 antibody, Retinoblastoma Binding Protein 7 antibody, MGC138868 antibody, RBBP 7, RbAp46 antibody, RBBP7
Specificity RBBP7 antibody was raised against the N terminal of RBBP7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH
Assay Information RBBP7 Blocking Peptide, catalog no. 33R-6545, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody


Western Blot analysis using RBBP7 antibody (70R-2124)

RBBP7 antibody (70R-2124) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBBP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBBP7 antibody (70R-2124) | RBBP7 antibody (70R-2124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors