RBJ antibody (70R-5875)

Rabbit polyclonal RBJ antibody raised against the middle region of RBJ

Synonyms Polyclonal RBJ antibody, Anti-RBJ antibody, Rab And Dnaj Domain Containing antibody, RabJS antibody, DKFZp434N211 antibody
Specificity RBJ antibody was raised against the middle region of RBJ
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBJ antibody was raised using the middle region of RBJ corresponding to a region with amino acids CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR
Assay Information RBJ Blocking Peptide, catalog no. 33R-1829, is also available for use as a blocking control in assays to test for specificity of this RBJ antibody

Images

Western Blot analysis using RBJ antibody (70R-5875)

RBJ antibody (70R-5875) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBJ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RBJ protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBJ antibody (70R-5875) | RBJ antibody (70R-5875) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors