RBM11 antibody (70R-4591)

Rabbit polyclonal RBM11 antibody raised against the middle region of RBM11

Synonyms Polyclonal RBM11 antibody, Anti-RBM11 antibody, RBM 11, RBM 11 antibody, RBM-11, RBM-11 antibody, RNA Binding Motif Protein 11 antibody, RBM11
Specificity RBM11 antibody was raised against the middle region of RBM11
Cross Reactivity Human
Applications WB
Immunogen RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR
Assay Information RBM11 Blocking Peptide, catalog no. 33R-8611, is also available for use as a blocking control in assays to test for specificity of this RBM11 antibody


Western Blot analysis using RBM11 antibody (70R-4591)

RBM11 antibody (70R-4591) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM11 antibody (70R-4591) | RBM11 antibody (70R-4591) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors