RBM12 antibody (70R-5030)

Rabbit polyclonal RBM12 antibody raised against the middle region of RBM12

Synonyms Polyclonal RBM12 antibody, Anti-RBM12 antibody, RBM 12, HRIHFB2091 antibody, KIAA0765 antibody, RBM-12 antibody, RBM 12 antibody, SWAN antibody, RNA Binding Motif Protein 12 antibody, RBM-12, RBM12
Specificity RBM12 antibody was raised against the middle region of RBM12
Cross Reactivity Human
Applications WB
Immunogen RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR
Assay Information RBM12 Blocking Peptide, catalog no. 33R-9691, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Images

Western Blot analysis using RBM12 antibody (70R-5030)

RBM12 antibody (70R-5030) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBM12 antibody (70R-5030) | RBM12 antibody (70R-5030) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors