RBM34 antibody (70R-4948)

Rabbit polyclonal RBM34 antibody raised against the C terminal of RBM34

Synonyms Polyclonal RBM34 antibody, Anti-RBM34 antibody, RBM 34, RBM-34, RBM 34 antibody, RBM-34 antibody, RBM34, KIAA0117 antibody, RNA Binding Motif Protein 34 antibody
Specificity RBM34 antibody was raised against the C terminal of RBM34
Cross Reactivity Human
Applications WB
Immunogen RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK
Assay Information RBM34 Blocking Peptide, catalog no. 33R-8563, is also available for use as a blocking control in assays to test for specificity of this RBM34 antibody


Western Blot analysis using RBM34 antibody (70R-4948)

RBM34 antibody (70R-4948) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM34 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM34 antibody (70R-4948) | RBM34 antibody (70R-4948) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors