RBM35B antibody (70R-4967)

Rabbit polyclonal RBM35B antibody raised against the N terminal of RBM35B

Synonyms Polyclonal RBM35B antibody, Anti-RBM35B antibody, RBM-35, RBM 35 antibody, RBM-35 antibody, FLJ21918 antibody, RNA Binding Motif Protein 35B antibody, FLJ22248 antibody, RBM 35, RBM35
Specificity RBM35B antibody was raised against the N terminal of RBM35B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM35B antibody was raised using the N terminal of RBM35B corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ
Assay Information RBM35B Blocking Peptide, catalog no. 33R-1548, is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Images

Western Blot analysis using RBM35B antibody (70R-4967)

RBM35B antibody (70R-4967) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM35B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBM35B antibody (70R-4967) | RBM35B antibody (70R-4967) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors