RBM38 antibody (70R-4914)

Rabbit polyclonal RBM38 antibody raised against the N terminal of RBM38

Synonyms Polyclonal RBM38 antibody, Anti-RBM38 antibody, RBM 38 antibody, RBM 38, RBM-38 antibody, RBM38, RNA Binding Motif Protein 38 antibody, RBM-38
Specificity RBM38 antibody was raised against the N terminal of RBM38
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER
Assay Information RBM38 Blocking Peptide, catalog no. 33R-5295, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody


Immunohistochemical staining using RBM38 antibody (70R-4914)

RBM38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM38 is a probable RNA-binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RBM38 antibody (70R-4914) | RBM38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RBM38 antibody (70R-4914) | RBM38 antibody (70R-4914) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors