RBM38 antibody (70R-4915)

Rabbit polyclonal RBM38 antibody raised against the middle region of RBM38

Synonyms Polyclonal RBM38 antibody, Anti-RBM38 antibody, RBM38, RBM 38, SEB4D antibody, RBM-38 antibody, RBM 38 antibody, RBM-38, SEB4B antibody, RNPC1 antibody, HSRNASEB antibody, RNA Binding Motif Protein 38 antibody, dJ800J21.2 antibody
Specificity RBM38 antibody was raised against the middle region of RBM38
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM
Assay Information RBM38 Blocking Peptide, catalog no. 33R-7794, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody


Western Blot analysis using RBM38 antibody (70R-4915)

RBM38 antibody (70R-4915) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM38 is a probable RNA-binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM38 antibody (70R-4915) | RBM38 antibody (70R-4915) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors