RBM39 antibody (70R-4669)

Rabbit polyclonal RBM39 antibody raised against the middle region of RBM39

Synonyms Polyclonal RBM39 antibody, Anti-RBM39 antibody, RBM-39, RBM 39 antibody, RBM39, RNA Binding Motif Protein 39 antibody, RBM 39, RBM-39 antibody
Specificity RBM39 antibody was raised against the middle region of RBM39
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
Assay Information RBM39 Blocking Peptide, catalog no. 33R-3048, is also available for use as a blocking control in assays to test for specificity of this RBM39 antibody

Images

Western Blot analysis using RBM39 antibody (70R-4669)

RBM39 antibody (70R-4669) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBM39 antibody (70R-4669) | RBM39 antibody (70R-4669) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors