RBM47 antibody (70R-4958)

Rabbit polyclonal RBM47 antibody raised against the middle region of RBM47

Synonyms Polyclonal RBM47 antibody, Anti-RBM47 antibody, RNA Binding Motif Protein 47 antibody, FLJ21643 antibody, RBM 47 antibody, DKFZp686F02235 antibody, RBM 47, RBM47, RBM-47, RBM-47 antibody, FLJ21344 antibody, FLJ20273 antibody
Specificity RBM47 antibody was raised against the middle region of RBM47
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
Assay Information RBM47 Blocking Peptide, catalog no. 33R-3730, is also available for use as a blocking control in assays to test for specificity of this RBM47 antibody


Western blot analysis using RBM47 antibody (70R-4958)

Recommended RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM47 may be involved in RNA binding and nucleotide binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RBM47 antibody (70R-4958) | Recommended RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226
  • Western blot analysis using RBM47 antibody (70R-4958) | Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using RBM47 antibody (70R-4958) | Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using RBM47 antibody (70R-4958) | Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using RBM47 antibody (70R-4958) | Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors