RBM7 antibody (70R-4859)

Rabbit polyclonal RBM7 antibody raised against the middle region of RBM7

Synonyms Polyclonal RBM7 antibody, Anti-RBM7 antibody, FLJ11153 antibody, RBM 7, RNA Binding Motif Protein 7 antibody, RBM-7, RBM 7 antibody, RBM7, RBM-7 antibody
Specificity RBM7 antibody was raised against the middle region of RBM7
Cross Reactivity Human
Applications WB
Immunogen RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR
Assay Information RBM7 Blocking Peptide, catalog no. 33R-8434, is also available for use as a blocking control in assays to test for specificity of this RBM7 antibody

Images

Western Blot analysis using RBM7 antibody (70R-4859)

RBM7 antibody (70R-4859) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBM7 antibody (70R-4859) | RBM7 antibody (70R-4859) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors