RBM9 antibody (70R-5890)

Rabbit polyclonal RBM9 antibody raised against the middle region of RBM9

Synonyms Polyclonal RBM9 antibody, Anti-RBM9 antibody, RBM9, fxh antibody, RBM 9, RBM 9 antibody, dJ106I20.3 antibody, RTA antibody, HRNBP2 antibody, RBM-9 antibody, RBM-9, RNA Binding Motif Protein 9 antibody, Fox-2 antibody, HNRBP2 antibody
Specificity RBM9 antibody was raised against the middle region of RBM9
Cross Reactivity Human
Applications WB
Immunogen RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
Assay Information RBM9 Blocking Peptide, catalog no. 33R-7280, is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody


Western blot analysis using RBM9 antibody (70R-5890)

Recommended RBM9 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RBM9 antibody (70R-5890) | Recommended RBM9 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors