RBMS2 antibody (70R-4740)

Rabbit polyclonal RBMS2 antibody raised against the N terminal of RBMS2

Synonyms Polyclonal RBMS2 antibody, Anti-RBMS2 antibody, RBMS-2, RBMS 2 antibody, SCR3 antibody, RBMS2, RBMS-2 antibody, RBMS 2, RNA Binding Motif Single Stranded Interacting Protein 2 antibody
Specificity RBMS2 antibody was raised against the N terminal of RBMS2
Cross Reactivity Human
Applications WB
Immunogen RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN
Assay Information RBMS2 Blocking Peptide, catalog no. 33R-6197, is also available for use as a blocking control in assays to test for specificity of this RBMS2 antibody

Images

Western Blot analysis using RBMS2 antibody (70R-4740)

RBMS2 antibody (70R-4740) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBMS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBMS2 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBMS2 antibody (70R-4740) | RBMS2 antibody (70R-4740) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors