RBMX Blocking Peptide (33R-10408)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBMX antibody, catalog no. 70R-10373

Synonyms RBMX control peptide, RBMX antibody Blocking Peptide, Anti-RBMX Blocking Peptide, RNA binding motif protein, X-linked Blocking Peptide, HNRPG Blocking Peptide, RBMXP1 Blocking Peptide, RBMXRT Blocking Peptide, RNMX Blocking Peptide, hnRNP-G Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors