RBMY1A1 antibody (70R-4807)

Rabbit polyclonal RBMY1A1 antibody raised against the N terminal of RBMY1A1

Synonyms Polyclonal RBMY1A1 antibody, Anti-RBMY1A1 antibody, RBMYA-1 antibody, RBMYA-1, RBMYA 1, RBMY antibody, RBM1 antibody, RBMYA 1 antibody, YRRM2 antibody, RNA Binding Motif Protein Y-Linked Family 1 Member A1 antibody, RBMY1A1, RBM2 antibody, YRRM1 antibody
Specificity RBMY1A1 antibody was raised against the N terminal of RBMY1A1
Cross Reactivity Human
Applications WB
Immunogen RBMY1A1 antibody was raised using the N terminal of RBMY1A1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN
Assay Information RBMY1A1 Blocking Peptide, catalog no. 33R-6530, is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody

Images

Western Blot analysis using RBMY1A1 antibody (70R-4807)

RBMY1A1 antibody (70R-4807) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBMY1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBMY1A1 antibody (70R-4807) | RBMY1A1 antibody (70R-4807) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors