RBP4 antibody (70R-5457)

Rabbit polyclonal RBP4 antibody raised against the N terminal of RBP4

Synonyms Polyclonal RBP4 antibody, Anti-RBP4 antibody, Retinol Binding Protein 4 Plasma antibody
Specificity RBP4 antibody was raised against the N terminal of RBP4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP
Assay Information RBP4 Blocking Peptide, catalog no. 33R-6173, is also available for use as a blocking control in assays to test for specificity of this RBP4 antibody

Images

Western Blot analysis using RBP4 antibody (70R-5457)

RBP4 antibody (70R-5457) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBP4 antibody (70R-5457) | RBP4 antibody (70R-5457) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors