RBPMS2 antibody (70R-4986)

Rabbit polyclonal RBPMS2 antibody raised against the middle region of RBPMS2

Synonyms Polyclonal RBPMS2 antibody, Anti-RBPMS2 antibody, RNA Binding Protein With Multiple Splicing 2 antibody
Specificity RBPMS2 antibody was raised against the middle region of RBPMS2
Cross Reactivity Human
Applications WB
Immunogen RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP
Assay Information RBPMS2 Blocking Peptide, catalog no. 33R-1410, is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody


Western Blot analysis using RBPMS2 antibody (70R-4986)

RBPMS2 antibody (70R-4986) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBPMS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBPMS2 contains 1 RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBPMS2 antibody (70R-4986) | RBPMS2 antibody (70R-4986) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors