RCAN3 antibody (70R-5883)

Rabbit polyclonal RCAN3 antibody raised against the middle region of RCAN3

Synonyms Polyclonal RCAN3 antibody, Anti-RCAN3 antibody, hRCN3 antibody, MCIP3 antibody, RCAN 3 antibody, Rcan Family Member 3 antibody, RCAN-3, RCAN-3 antibody, DSCR1L2 antibody, RCN3 antibody, RCAN3, RCAN 3
Specificity RCAN3 antibody was raised against the middle region of RCAN3
Cross Reactivity Human
Applications WB
Immunogen RCAN3 antibody was raised using the middle region of RCAN3 corresponding to a region with amino acids PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA
Assay Information RCAN3 Blocking Peptide, catalog no. 33R-7100, is also available for use as a blocking control in assays to test for specificity of this RCAN3 antibody

Images

Western Blot analysis using RCAN3 antibody (70R-5883)

RCAN3 antibody (70R-5883) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RCAN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RCAN3 antibody (70R-5883) | RCAN3 antibody (70R-5883) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors