RCC2 antibody (70R-3169)

Rabbit polyclonal RCC2 antibody raised against the middle region of RCC2

Synonyms Polyclonal RCC2 antibody, Anti-RCC2 antibody, RCC-2 antibody, TD-60 antibody, Regulator Of Chromosome Condensation 2 antibody, RCC 2 antibody, RCC 2, RCC-2, DKFZp762N0610 antibody, KIAA1470 antibody, RCC2
Specificity RCC2 antibody was raised against the middle region of RCC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
Assay Information RCC2 Blocking Peptide, catalog no. 33R-7978, is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody


Western Blot analysis using RCC2 antibody (70R-3169)

RCC2 antibody (70R-3169) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RCC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RCC2 antibody (70R-3169) | RCC2 antibody (70R-3169) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors