RCE1 antibody (70R-1807)

Rabbit polyclonal RCE1 antibody

Synonyms Polyclonal RCE1 antibody, Anti-RCE1 antibody, RCE1A antibody, FACE2 antibody, RCE 1, RCE1, RCE-1 antibody, Rce1 Homolog Prenyl Protein Peptidase antibody, RCE 1 antibody, RCE-1, RCE1B antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF
Assay Information RCE1 Blocking Peptide, catalog no. 33R-9934, is also available for use as a blocking control in assays to test for specificity of this RCE1 antibody

Images

Western Blot analysis using RCE1 antibody (70R-1807)

RCE1 antibody (70R-1807) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RCE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RCE1 antibody (70R-1807) | RCE1 antibody (70R-1807) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors