RDH10 antibody (70R-7462)

Rabbit polyclonal RDH10 antibody

Synonyms Polyclonal RDH10 antibody, Anti-RDH10 antibody, RDH10, RDH 10 antibody, All-Trans antibody, RDH 10, RDH-10, RDH-10 antibody, Retinol Dehydrogenase 10 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
Assay Information RDH10 Blocking Peptide, catalog no. 33R-7732, is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody

Images

Western Blot analysis using RDH10 antibody (70R-7462)

RDH10 antibody (70R-7462) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDH10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RDH10 antibody (70R-7462) | RDH10 antibody (70R-7462) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors