RDH11 antibody (70R-5410)

Rabbit polyclonal RDH11 antibody

Synonyms Polyclonal RDH11 antibody, Anti-RDH11 antibody, RDH 11 antibody, RALR1 antibody, SCALD antibody, RDH-11 antibody, RDH 11, FLJ32633 antibody, PSDR1 antibody, RDH-11, MDT1 antibody, CGI-82 antibody, RDH11, Retinol Dehydrogenase 11 antibody, ARSDR1 antibody, All-Trans/9-Cis/11-Cis antibody, HCBP12 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR
Assay Information RDH11 Blocking Peptide, catalog no. 33R-8425, is also available for use as a blocking control in assays to test for specificity of this RDH11 antibody

Images

Western Blot analysis using RDH11 antibody (70R-5410)

RDH11 antibody (70R-5410) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDH11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RDH11 antibody (70R-5410) | RDH11 antibody (70R-5410) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors