RDH12 antibody (70R-5393)

Rabbit polyclonal RDH12 antibody

Synonyms Polyclonal RDH12 antibody, Anti-RDH12 antibody, RDH-12, RDH 12, RDH-12 antibody, FLJ30273 antibody, Retinol Dehydrogenase 12 antibody, LCA3 antibody, All-Trans/9-Cis/11-Cis antibody, RDH 12 antibody, RDH12
Cross Reactivity Human
Applications WB
Immunogen RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV
Assay Information RDH12 Blocking Peptide, catalog no. 33R-3754, is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody


Western Blot analysis using RDH12 antibody (70R-5393)

RDH12 antibody (70R-5393) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDH12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RDH12 antibody (70R-5393) | RDH12 antibody (70R-5393) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors