Rec8 antibody (70R-5548)

Rabbit polyclonal Rec8 antibody

Synonyms Polyclonal Rec8 antibody, Anti-Rec8 antibody, MGC950 antibody, Rec8, Rec8p antibody, Rec-8, Rec 8 antibody, REC8L1 antibody, HR21spB antibody, Rec-8 antibody, Rec8 Homolog antibody, Rec 8
Cross Reactivity Human
Applications WB
Immunogen Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
Assay Information Rec8 Blocking Peptide, catalog no. 33R-7641, is also available for use as a blocking control in assays to test for specificity of this Rec8 antibody

Images

Western Blot analysis using Rec8 antibody (70R-5548)

Rec8 antibody (70R-5548) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of REC8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Rec8 antibody (70R-5548) | Rec8 antibody (70R-5548) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors