RecQL5 antibody (70R-4612)

Rabbit polyclonal RecQL5 antibody raised against the middle region of RECQL5

Synonyms Polyclonal RecQL5 antibody, Anti-RecQL5 antibody, RecQL5, RecQL-5 antibody, RecQL 5, Recq Protein-Like 5 antibody, RecQL-5, RecQL 5 antibody, RECQ5 antibody, FLJ90603 antibody
Specificity RecQL5 antibody was raised against the middle region of RECQL5
Cross Reactivity Human
Applications WB
Immunogen RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
Assay Information RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody


Western Blot analysis using RecQL5 antibody (70R-4612)

RecQL5 antibody (70R-4612) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 109 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RECQL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RECQL5 may have an important role in DNA metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RecQL5 antibody (70R-4612) | RecQL5 antibody (70R-4612) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors